Protein Info for mRNA_7541 in Rhodosporidium toruloides IFO0880

Name: 15909
Annotation: K04564 SOD2 superoxide dismutase, Fe-Mn family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF00081: Sod_Fe_N" amino acids 19 to 97 (79 residues), 103.7 bits, see alignment E=6.2e-34 PF02777: Sod_Fe_C" amino acids 109 to 208 (100 residues), 116.5 bits, see alignment E=5.6e-38

Best Hits

Swiss-Prot: 58% identical to SODM_GANMI: Superoxide dismutase [Mn], mitochondrial from Ganoderma microsporum

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 60% identity to cne:CNI01590)

MetaCyc: 53% identical to Superoxide dismutase [Mn], mitochondrial (Homo sapiens)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>mRNA_7541 K04564 SOD2 superoxide dismutase, Fe-Mn family (Rhodosporidium toruloides IFO0880)
MFRATTRAMAAYNKIPAVLPKLPFAYNALEPAISSQIMELHHSKHHATYVANFNKAHEDI
QAASQAQDIKKQIALQAAIKFNGGGHINHTLFWENLAPQSQGGGQFPSSGKLHDQVQQDF
GGLDGLKKAVNAAALGIQGSGWAWLGYNPTTKKLEAVSTANQDPLLGYVPLVGIDMWEHA
YYIDYKNVKASYLDNIWSVINWQTAEKRLSEA