Protein Info for mRNA_7546 in Rhodosporidium toruloides IFO0880

Name: 15914
Annotation: K04523 UBQLN, DSK2 ubiquilin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF11976: Rad60-SLD" amino acids 42 to 111 (70 residues), 34.7 bits, see alignment E=1.9e-12 PF00240: ubiquitin" amino acids 44 to 112 (69 residues), 66 bits, see alignment E=3.1e-22 PF00627: UBA" amino acids 365 to 401 (37 residues), 22.4 bits, see alignment 1.4e-08

Best Hits

KEGG orthology group: K04523, ubiquilin (inferred from 39% identity to cne:CNB01010)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>mRNA_7546 K04523 UBQLN, DSK2 ubiquilin (Rhodosporidium toruloides IFO0880)
MERGVAGQGRSGEGLPPSSPSHTAHIAQTASEMADSSSETFTLNIKAPADQRFSVTVPAS
STVEQLKEEIAKAKEDFPVDQQRLIFSGRVLKNEDPISKYGIKAGVAIHLVKGARPAGAA
STSSTPAARNSSEAAGVPSNFAAGQQVMGNPLAPLMNAQYAGALGGFNPFAQMGVNTNDP
NYMQNMMNNPEVQAQMNRLLQDPAVLDQIIASSPQLQQMGPYARQIMQSEHFRNMITNPQ
AMQQAMQMMGGMGGMGGGAGAAPFPPPGAFGAAQGQQGAGTDSAAGAGAGAESAGSPPPA
FNPFAMFGGGAGAGPGAGGAGGQQPDMGAALAQMQQLQSLFGGFGGAGAGGAGAGGPQQS
PEERYATELEQLRGMGFTNATRNVRALLASGGFVDSAVAWLLENPE