Protein Info for mRNA_7567 in Rhodosporidium toruloides IFO0880

Name: 15935
Annotation: KOG2290 Rhomboid family proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 transmembrane" amino acids 354 to 374 (21 residues), see Phobius details amino acids 465 to 483 (19 residues), see Phobius details amino acids 503 to 523 (21 residues), see Phobius details amino acids 529 to 548 (20 residues), see Phobius details amino acids 560 to 576 (17 residues), see Phobius details amino acids 582 to 602 (21 residues), see Phobius details amino acids 611 to 631 (21 residues), see Phobius details amino acids 670 to 689 (20 residues), see Phobius details PF01694: Rhomboid" amino acids 461 to 600 (140 residues), 110.6 bits, see alignment E=3.6e-36

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (690 amino acids)

>mRNA_7567 KOG2290 Rhomboid family proteins (Rhodosporidium toruloides IFO0880)
MQPSDLYARPAPPSDLASDNFHWSSDAASTIAPEDSVSQLDRRFTGRRRMLGPRPMDAPP
VPGVPEEYTEELRGEYVPPEMIAEGDEDEKSTVVPAQPVKRSQAVGPLARARGEGSGGGS
NTSGAAIPYVSPLQHPRDNYAADEDDDDSRPLVPSSGPAPSSSRSAPTPAPASTITPYSR
TKGYAALGHDDADAYDDDGGVYAAYSRSRDEDLESKAGMRAVERESSSSAATGSRGLAGA
LSDPVGYLRQSIRGRGGKSRTDRDRDGSFYMPNELAFRPPSSSSLDKHPSYPPPTPNSYP
LSKIPSLDVAPATDRGANGEQIRPDPLWKRWIWDGTDQERRVWEHKRGVGMQRWPFASWA
LAVVMTAVLIYELVKMKSYTGSPIQTKPSFNVMIGPSAEVLINLGARFAGCIKYISGVTD
LTWTCLQDTNMSTLSSTDAQCTMSDVCGFGGFQIVDGTGGPNQSFRFFVPIFLHAGVVHL
LLNMLAQCTSSAQVERMMGTPRFLIVYLAAGIFGFVLGANFALVGQPSVGASGAIFGTHA
ALLVDLLAHWKIEYRPLRKLLFLVVEIIIGLGLGWVPGVDNFAHLGGFLMGLLTSVLLFP
IVHPSRTHKYIFIGLRLLALPLVVVVFVVLVRNFYTGDPATACSWCRYLSCWPTAANNHC
KGTGLATYSTSSTLPSLLTILFSTFVLPLL