Protein Info for mRNA_7574 in Rhodosporidium toruloides IFO0880

Name: 15942
Annotation: K15275 SLC35B1 solute carrier family 35 (UDP-galactose transporter), member B1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 310 to 340 (31 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details PF08449: UAA" amino acids 14 to 377 (364 residues), 137.2 bits, see alignment E=3.6e-44

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>mRNA_7574 K15275 SLC35B1 solute carrier family 35 (UDP-galactose transporter), member B1 (Rhodosporidium toruloides IFO0880)
MAAQDTRVNPLVQLGICVGGIYVSFLVWALCQERLSTTPYLSTGTFPTSDKFRSVLFMNT
VQSIFSVFSAFLYLVITKKRHGVTWGEVLGLPSARSQPTLPKEKAIVNEVNGMNGMAPHK
STDAGRLLRLYAFIALVASSAAPFGFLALSHISFPTLLLGKSCKLVPVMLMNILLYRRKF
PFHKYALVALVTAGIWAFMAFKPSKPGKVGGRETSSVLGLALLAINLIFDGVVNATQDHV
FSTFTLDGEQMMFFMNAFASLYTFAALIFPFSLTPSFLLPASAASGAHFNELSSALAFIR
THPSVKLDILLFGLTGSIGQLFIFATLSLYGSLTLVTITVTRKMATMLLSVFVFEHRLTK
GQWAGVGMVFGAVAMEAIIARREKKHKKAGRKEA