Protein Info for mRNA_7595 in Rhodosporidium toruloides IFO0880

Name: 15963
Annotation: K02151 ATPeV1F, ATP6S14 V-type H+-transporting ATPase subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01101: V-type ATPase, F subunit
  • amino acids 9 to 118 (110 residues), 152.3 bits, E=3.3e-49
• PF01990: ATP-synt_F
  • amino acids 13 to 114 (102 residues), 104.1 bits, E=2e-34

Best Hits

Swiss-Prot: 61% identical to VATF_NEOFI: V-type proton ATPase subunit F (vma7) from Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)

KEGG orthology group: K02151, V-type H+-transporting ATPase subunit F [EC: 3.6.3.14] (inferred from 74% identity to scm:SCHCODRAFT_51487)

MetaCyc: 52% identical to H+-translocating V-ATPase subunit F (Homo sapiens)
ATPSYN-RXN [EC: 7.1.2.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• ATP biosynthesis (1/1 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Protein Sequence (120 amino acids)

>mRNA_7595 K02151 ATPeV1F, ATP6S14 V-type H+-transporting ATPase subunit F (Rhodosporidium toruloides IFO0880)
MSNATQYRDRSLIATIGDEDTITGLLLAGTGHIDGRGKKNFLVVDSKTPVSTIESAFAEF
TERSDIAILLINQHVAEMIRPTIEKYQQAFPALLEIPAKDHPYDPSKDSVLKAVKKHLGE