Protein Info for mRNA_7625 in Rhodosporidium toruloides IFO0880

Name: 15993
Annotation: HMMPfam-Hypoxia induced protein conserved region-PF04588,ProSiteProfiles-HIG1 domain profile.-PS51503

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details PF04588: HIG_1_N" amino acids 131 to 179 (49 residues), 24.2 bits, see alignment 1.6e-09

Best Hits

KEGG orthology group: None (inferred from 36% identity to ure:UREG_03380)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>mRNA_7625 HMMPfam-Hypoxia induced protein conserved region-PF04588,ProSiteProfiles-HIG1 domain profile.-PS51503 (Rhodosporidium toruloides IFO0880)
MVKAAPRSDEQQHYHATVMGGLKGGAMGLAAGGAGAVALQRANVQAFTRLTLPLKAFAVT
SVGTAAFIISADKASREFELAKYAVGSGTALERSSHEQQRLEQEAGIADGKPKRSTPVST
KEAVVEWAKENRWTAVGLSWAASMVGSGAYIAATPLTFAQKLVQARMVAQGVTVVALLGS
AALTQIPNAQGKSDEDLKREERESTMYAWKKDSPHYKHESKQE