Protein Info for mRNA_7642 in Rhodosporidium toruloides IFO0880

Name: 16010
Annotation: K06943 NOG1 nucleolar GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 PF17835: NOG1_N" amino acids 8 to 165 (158 residues), 167.2 bits, see alignment E=7.4e-53 PF02421: FeoB_N" amino acids 171 to 306 (136 residues), 32.2 bits, see alignment E=1.9e-11 PF01926: MMR_HSR1" amino acids 172 to 290 (119 residues), 60.9 bits, see alignment E=3.1e-20 PF06858: NOG1" amino acids 235 to 292 (58 residues), 92 bits, see alignment 4.1e-30 PF08155: NOGCT" amino acids 396 to 449 (54 residues), 100.2 bits, see alignment 1.2e-32

Best Hits

Swiss-Prot: 63% identical to NOG1_SCHPO: Probable nucleolar GTP-binding protein 1 (nog1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K06943, nucleolar GTP-binding protein (inferred from 66% identity to uma:UM01252.1)

Predicted SEED Role

"GTP-binding protein, gtp1/obg family" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>mRNA_7642 K06943 NOG1 nucleolar GTP-binding protein (Rhodosporidium toruloides IFO0880)
MSGTINKAIAPVPTAQEFLDVILSKTQRKTPTVIRSGFKISRIRSFYMRKVKFTQASFEE
RLDQILSEFPVMDNLHPFLNSLLNVLYDKNHYKLALGQLNTARHLIVQVGKDYCRLIKFG
DSLYRCKQLKKAALGRMATIMKRQKDPLAYLEQVRQHMSRLPQIDPTTRTLLICGYPNVG
KSSFVNKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVIDTPGVLDHPLEEMNTIEMQS
ITALAHLRACVLYFMDLSEQCGFTVEAQCKLYQSIKPLFANKPTFIVINKIDIVRPEDLD
PERKAMLDAILAEDQVSLLSLSCVSEEGIMDVRNSACDALLAHRVEAKEKTRRVENVANR
VRVAVPVPRDGVERKAFIPDAVKSRKAYDKSDSERRRLERDIEEENGGAGVHSVDLKKNY
MLKNDEWKYDVIPEIQDGKNVADFIDPDILAKLDELEEEEERLEKAGFYDSESDVDSDEE
AIRTAASTIRDKKALIRLKNADKHKLQNRPIIPRKEQSRTLSEMTEKLKEAGYDASSLEE
RALLLAKAKGLVGRKRGADSDDEMDQDESFADEGDDAEMDVDEDAQASKKRRTSSSGSIV
AKGKRVPGSNRQLAGLKDDEQDKKAKRLRSLAQRAPNRLARAGEGDRHETAAIPKWLFSG
KRKAGKTNRR