Protein Info for mRNA_7650 in Rhodosporidium toruloides IFO0880

Name: 16018
Annotation: K08008 NOX, GP91 NADPH oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 142 to 161 (20 residues), see Phobius details amino acids 181 to 206 (26 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 329 to 332 (4 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 391 to 406 (16 residues), see Phobius details amino acids 486 to 506 (21 residues), see Phobius details PF01794: Ferric_reduct" amino acids 197 to 319 (123 residues), 55.2 bits, see alignment E=1.2e-18 PF08022: FAD_binding_8" amino acids 366 to 477 (112 residues), 88.4 bits, see alignment E=5.2e-29 PF08030: NAD_binding_6" amino acids 484 to 634 (151 residues), 120.8 bits, see alignment E=9.5e-39

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (654 amino acids)

>mRNA_7650 K08008 NOX, GP91 NADPH oxidase (Rhodosporidium toruloides IFO0880)
MVLFPAFVQNGRFSLAHRRTPSSTAHLDSLPAHTAATVLPTGSSFDTSYSEAGKLGLEPA
PHVVVPLTPRSDFDSSLSRSTSRAVRRPEEVKRQNETEQDRLQGLMRSATIRRIESREEK
AGEEGDRWLRAKVWLRQDGPSALVLLVWLLLQLGFFAVGVVRYDLNRNFSNARAIFGSTY
VIARSAAFVLHIDVVFILLPICRNLVTLLRRTALNKAIPFDESVEFHKVVAWSLVFWTAV
HTIAHLFNSWWLGAKLATTATAALLLALDTNFTTGPFLTGWIMLVLLGVMAFFAVEKRRR
PHFQRFYWSHHLFIPFFVLWQFHGMFCMINWTQIGVFWMYWILGGLVYIGERILREIRSR
HRTYLSKVVVHPSNVIELRIKKEKTPRVRPGQYIMICCPSVSYWQWHPFTLTSAPEEDFL
SVHIRVVGDWTRQLAIVLGCEQDKELLSEEWTREKLLSPSVIRPLPRVMVDGPFGTATED
VLKYEVTVLVGAGIGVTPFAAILKHIWYRLKDPDRDPLDQKLRKVYFFWICRDAESFEWF
RDLLHSLEEQDVDGRIEIHTYLTATIKAHDMLNIFANDVGSDRDAITQLRAPTHYGRPNW
DRIFASIAAEHPASEVGVFFCGPKPLSTTLYKMCIKHTTGEAGRTRFTFSKERF