Protein Info for mRNA_7662 in Rhodosporidium toruloides IFO0880

Name: 16030
Annotation: K13519 LPT1, ALE1 lysophospholipid acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 51 to 76 (26 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 447 to 470 (24 residues), see Phobius details amino acids 485 to 506 (22 residues), see Phobius details PF03062: MBOAT" amino acids 124 to 404 (281 residues), 145.4 bits, see alignment E=1.5e-46

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>mRNA_7662 K13519 LPT1, ALE1 lysophospholipid acyltransferase (Rhodosporidium toruloides IFO0880)
MLLDGTAGYLAEQLGAEPSQIKVILLLVASVPLSLAYPWFPSTTRSQLAHLYSLVPSIIF
LCFVLDLGLGFVQLLASSLATWSIVRIGSRNNWGALMPWTVFAIVMGHLAVNHIERSLNN
VPVTTIEITGSQMVLVMKLISFAWSVYDGQRPLEELDATQKASRIEEVPGLLPFLGYAFF
FPSILAGPSFTYRSFDSFTTHRLFAKEHPADGSKPVDPTVIPPGRRRKAAKRFATGIIYL
AIFSTYGWKYGMNRLIDRKAVAGLTFVQKFTLMNVAGFIARTKYYAVWCIAESAFIISGL
GYNPQTKHYDASRNVRIRSIELAPNFKVLLDSWNMNTNVWLRECIYKRVAKKGRKPGFKS
TQITFITSALWHGTNPCYLMTFVLGGFCQAVNRSLRAGLRPFFLPPGALNVPNPAANEVK
VGDKAISLPSTPRVKLQPPPQTPLKTLYDVLGTICTIVVLNFAVVPFLLLDVQSSLQAWA
EVKFYALWMVFVPFFVLNVCGGTAYLKRLQRARDKKAEGKRRSKEEQELERKRVEWEKAE
EDKRRRRGEGLPSFGLDVEGMVEEEEREEMRGESVEGRKEL