Protein Info for mRNA_7663 in Rhodosporidium toruloides IFO0880

Name: 16031
Annotation: K03305 TC.POT proton-dependent oligopeptide transporter, POT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 67 to 83 (17 residues), see Phobius details amino acids 137 to 154 (18 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 369 to 386 (18 residues), see Phobius details amino acids 407 to 430 (24 residues), see Phobius details amino acids 443 to 465 (23 residues), see Phobius details amino acids 493 to 512 (20 residues), see Phobius details amino acids 524 to 546 (23 residues), see Phobius details amino acids 553 to 573 (21 residues), see Phobius details PF00854: PTR2" amino acids 157 to 548 (392 residues), 267.1 bits, see alignment E=1.2e-83

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 55% identity to pcs:Pc16g00660)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (601 amino acids)

>mRNA_7663 K03305 TC.POT proton-dependent oligopeptide transporter, POT family (Rhodosporidium toruloides IFO0880)
MSGSDPTEASFEALSHRLDENSRAKNGKDDDGFVFEEKRAPSQTTGDDEDYPDAPTEEEK
MTLRRVAGPINIASFLIGFIELAERFSYYGSTQVFTNFIQQPLPEGSTTGSSHAGQTSGA
LGMGQQASTGLTTFNQFWVYTMPLFGAYIADTYLGRFNTIAWAILICMIGHILLVVSALP
SVIAHPNSAIGVFAVAIIIMGVGTGFFKSNISPLIAEQVASHRLYVKTLKNGERVLVDPA
ATTARMYNWFYLLINVGALAGQLGMVYAEKRVGFWLAFTLPTVVFALTPFVLFFGKNKYN
RTPPAGSSLGKAFRILNINFKRAGFSPKAWKRSDFWMAALPSQFATAEKPAWMTWDDTFV
WEVRRGFKACQVFLWLPLYWLCYNQINNNLTSQAAVLNTHGLPNDVLANLDPFALIILIP
IFDLGVYPALRRAGINFSPVKKMFAGFIFASLSMVCATAVQAHIYATSACGTHAATCDEM
PFIPTNVWIQTPSYVLLALSEIFASITSLEYAYTKAPKSMRSMVMAVGLFMTAISAALGE
AFLALSADPLLTWNYGTFAVISFVGGIIFWFTFSKLDKEEDSLNEIKEGKRSDDAEPKQV
V