Protein Info for mRNA_7669 in Rhodosporidium toruloides IFO0880
Name: 16037
Annotation: K06134 COQ7 ubiquinone biosynthesis monooxygenase Coq7
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K06134, ubiquinone biosynthesis monooxygenase Coq7 [EC: 1.14.13.-] (inferred from 46% identity to dgr:Dgri_GH24447)Predicted SEED Role
"Ubiquinone biosynthesis enzyme COQ7" in subsystem Ubiquinone Biosynthesis
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Bisphenol A degradation
- Brassinosteroid biosynthesis
- Carotenoid biosynthesis - General
- Cyanoamino acid metabolism
- Flavonoid biosynthesis
- Histidine metabolism
- Isoflavonoid biosynthesis
- Limonene and pinene degradation
- Methane metabolism
- Naphthalene and anthracene degradation
- Phenylalanine metabolism
- Phenylpropanoid biosynthesis
- Styrene degradation
- Toluene and xylene degradation
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
- gamma-Hexachlorocyclohexane degradation
Isozymes
Compare fitness of predicted isozymes for: 1.14.13.-
Use Curated BLAST to search for 1.14.13.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (260 amino acids)
>mRNA_7669 K06134 COQ7 ubiquinone biosynthesis monooxygenase Coq7 (Rhodosporidium toruloides IFO0880) MLARTPRTLVTPSAWRIIARAHSSHAAPPSFAPSGVTSADTEIPYGDPACASSAYLPQKD GARTQTEEEKRAVSETPELTPEQRDVLEKIIRVDQAGELGANYIYYGQKAVFAAGSDKRT TGIVQAMWDGEKKHIAAFDKLITQHNVRPTALYPVWKAMAFGLGAGTALMGKRAAMACTE AVETVIGEHYNEQLKQLKADFPDHPSIPLLEKILTEFRDDELEHLDTAVANESQQAPAYA LLSAVIAGGCRWAIKTTEKI