Protein Info for mRNA_7678 in Rhodosporidium toruloides IFO0880

Name: 16046
Annotation: K00657 speG diamine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF00583: Acetyltransf_1" amino acids 50 to 155 (106 residues), 52.8 bits, see alignment E=6.9e-18 PF13508: Acetyltransf_7" amino acids 79 to 155 (77 residues), 28.6 bits, see alignment E=2.3e-10 PF13673: Acetyltransf_10" amino acids 98 to 158 (61 residues), 33.9 bits, see alignment E=4.3e-12

Best Hits

Swiss-Prot: 34% identical to SAT2_PIG: Diamine acetyltransferase 2 (SAT2) from Sus scrofa

KEGG orthology group: None (inferred from 50% identity to scm:SCHCODRAFT_258541)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>mRNA_7678 K00657 speG diamine N-acetyltransferase (Rhodosporidium toruloides IFO0880)
MSAAPLSFDLHKVTPDNAAYTIPATLHLIKALALYERDPDAVEATEELLRNAFFGDEQGR
SYAQCVLAYTGGKPGEEGAKAIGMACYFFTFSTWTGRGGLYLEDLFVEEEYRGKGVSKAL
FRHLGQECEERKLPRMEWVVIDWNDPAKEVYRRMGAKHMSEWELMRLQGDALKKLAQ