Protein Info for mRNA_7686 in Rhodosporidium toruloides IFO0880

Name: 16054
Annotation: K06185 ABCF2 ATP-binding cassette, subfamily F, member 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF00005: ABC_tran" amino acids 41 to 198 (158 residues), 70.5 bits, see alignment E=9.8e-23 amino acids 355 to 490 (136 residues), 81.4 bits, see alignment E=4.2e-26 PF12848: ABC_tran_Xtn" amino acids 244 to 313 (70 residues), 74.9 bits, see alignment E=1.9e-24 PF13304: AAA_21" amino acids 451 to 517 (67 residues), 27.2 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 72% identical to YBP8_SCHPO: Uncharacterized ABC transporter ATP-binding protein C16H5.08c (SPBC16H5.08c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K06185, ATP-binding cassette, sub-family F, member 2 (inferred from 79% identity to uma:UM01341.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (555 amino acids)

>mRNA_7686 K06185 ABCF2 ATP-binding cassette, subfamily F, member 2 (Rhodosporidium toruloides IFO0880)
MAKLKIATDRSGSGVLTSDPQSRDIHIESYSLSFHGRLLIENADFSLNYGQRYGLLGENG
SGKTTFLESMANRDVEIPEHIDIYLVRGEAEPSEQTALEFVVQSAKDKAARLEARIEEMS
VADNVDEVALEMMYEELEELDPSMFEAKAGAILTGLGFGPEMMKKATKDMSGGWRMRVSL
AKALTIRPHLLLLDEPTNHLDLEAVVWLEAYLSTYNHILVITSHSQDFMDSVCTNILDLT
LERKFLTYGGNYSTYVRTKTENETNQMKAYAKQQEEIKHIKDFIASAGTYANLVKQAKSK
QKIIDKMEAAGFIKPIMKPKDLHFNFEDVKKLPPPIIAFNDVAFSYDGDMNKALYKDLSF
GIDMDSRIAIVGQNGTGKSTLLNLITGQLQPTKGSINRHPALKLAKYSQHSADQLPYDKS
PLEYMESTFKPKFPEKDIQYWRSCIGRFGISGTHQTSPIRQLSDGLRNRVVFAALALERP
DILLLDEPTNHLDMGSIDALARAIKEFSGGVVIVSHDFRLISQVAEQLWEVKEKKITDLS
KEDIGCDDSSAAVWA