Protein Info for mRNA_7694 in Rhodosporidium toruloides IFO0880

Name: 16062
Annotation: K12581 CNOT7_8, CAF1, POP2 CCR4-NOT transcription complex subunit 7/8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF04857: CAF1" amino acids 8 to 125 (118 residues), 46 bits, see alignment E=2.1e-16 amino acids 148 to 231 (84 residues), 30.3 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 65% identical to CNOT7_CHICK: CCR4-NOT transcription complex subunit 7 (CNOT7) from Gallus gallus

KEGG orthology group: K12581, CCR4-NOT transcription complex subunit 7/8 (inferred from 72% identity to uma:UM02425.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>mRNA_7694 K12581 CNOT7_8, CAF1, POP2 CCR4-NOT transcription complex subunit 7/8 (Rhodosporidium toruloides IFO0880)
MAERIKEVWANNLEEEMSYIRAAIEKYPFVAMDTEFPGVVARPIGSFRGSSDYHYQTLRC
NVDLLRIIQLGITLCDENGELAPGVCTWQFNFQFSINDDMYAPESIELLTKSGINFKRHE
EYGISVEEFGELLISSGLVLLDEVQWVSFHSGYDFGYLLKIVSCAPLPPTETEFFELLRI
WFPCIWDIKYLMKSCKTLKGGLQEVADDLGVSRIGPQHQAGSDSLLTAATFFKMRDKFFE
NKIEPKFMGVLYGLNSSSTPANPAYPREYNGAVHYPINVGTPTPSAAPLAAAASSAIAIM
SPSPKQRPAAT