Protein Info for mRNA_7727 in Rhodosporidium toruloides IFO0880

Name: 16095
Annotation: K13354 SLC25A17, PMP34 solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 216 to 234 (19 residues), see Phobius details PF00153: Mito_carr" amino acids 10 to 85 (76 residues), 36 bits, see alignment E=2.8e-13 amino acids 94 to 195 (102 residues), 51.9 bits, see alignment E=3e-18 amino acids 217 to 299 (83 residues), 59.4 bits, see alignment E=1.4e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>mRNA_7727 K13354 SLC25A17, PMP34 solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17 (Rhodosporidium toruloides IFO0880)
MVGMNDSSVHAVAGAAGGCIAMAVTYPLVNLSTRSQSTRSAALKVIQRDGIAGLYDGLSS
SLLGIAVTNGIYYLCFEEARAVVLKSRKGTRATLSTLESILVSAFAGAATSVLSNPIWVV
NTRQTVRTTVASDPTAPAGKKVVEKRRTIWQTIIDILRTDGPAAFFHGLGPALILVSNPI
LQFTLFEQLKNFILRRRALRLTKGNANAPPLTDLDFFLLGAVTKLFATSVTYPYLTVKAR
MQAGNAEGKSYTSSLDGLRKIIAREGPQGLYKGIAPKLTQSVATAALLFLAKEKIYNATR
KALIGTVAKNAAKA