Protein Info for mRNA_7760 in Rhodosporidium toruloides IFO0880

Name: 16128
Annotation: K05607 AUH methylglutaconyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF00378: ECH_1" amino acids 53 to 302 (250 residues), 199.4 bits, see alignment E=6.8e-63 PF16113: ECH_2" amino acids 57 to 226 (170 residues), 94.2 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 50% identical to ECH2M_ARATH: Probable enoyl-CoA hydratase 2, mitochondrial (At4g16800) from Arabidopsis thaliana

KEGG orthology group: K05607, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 59% identity to scm:SCHCODRAFT_47152)

MetaCyc: 40% identical to crotonase monomer (Clostridium acetobutylicum)
RXN-11667 [EC: 4.2.1.150]; 4.2.1.150 [EC: 4.2.1.150]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.150 or 4.2.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>mRNA_7760 K05607 AUH methylglutaconyl-CoA hydratase (Rhodosporidium toruloides IFO0880)
MLTLTRTHASTARFTRALILTHNHPHLVSLSRPYSTDPHPPAQASLTRSPTLEGLSFIQL
DRPKAKNALSVQLIRELRELFEEVRFDGWTRAVILRSAVPGSFCAGADLKERATMSQLDV
ARFLYNLRRLLGEIEDLPVPTIAAVDGPALGGGLELALACDLRVAGSTVTKIGLPETRLA
IIPGAGGTQRLSRLIGSSRAKDLIFASKILNAGEAERAGVVNYVSAEGQSASEKAEEVVG
EMLQAGPLALRAAKTAIDTGSQLDLESGLDVERLSYQTILQTEDRLEGLKAFAEKRKPVY
KGR