Protein Info for mRNA_7760 in Rhodosporidium toruloides IFO0880

Name: 16128
Annotation: K05607 AUH methylglutaconyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 53 to 302 (250 residues), 199.4 bits, E=6.8e-63
• PF16113: ECH_2
  • amino acids 57 to 226 (170 residues), 94.2 bits, E=1.2e-30

Best Hits

Swiss-Prot: 50% identical to ECH2M_ARATH: Probable enoyl-CoA hydratase 2, mitochondrial (At4g16800) from Arabidopsis thaliana

KEGG orthology group: K05607, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 59% identity to scm:SCHCODRAFT_47152)

MetaCyc: 40% identical to crotonase monomer (Clostridium acetobutylicum)
RXN-11667 [EC: 4.2.1.150]; 4.2.1.150 [EC: 4.2.1.150]

Predicted SEED Role

No annotation

MetaCyc Pathways

• oleate β-oxidation (26/35 steps found)
• L-leucine degradation I (5/6 steps found)
• L-valine degradation I (6/8 steps found)
• L-isoleucine degradation I (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• glycerol degradation to butanol (11/16 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• ferrichrome A biosynthesis (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (4/9 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• gallate degradation III (anaerobic) (2/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (5/18 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)

KEGG Metabolic Maps

• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.150 or 4.2.1.18

Protein Sequence (303 amino acids)

>mRNA_7760 K05607 AUH methylglutaconyl-CoA hydratase (Rhodosporidium toruloides IFO0880)
MLTLTRTHASTARFTRALILTHNHPHLVSLSRPYSTDPHPPAQASLTRSPTLEGLSFIQL
DRPKAKNALSVQLIRELRELFEEVRFDGWTRAVILRSAVPGSFCAGADLKERATMSQLDV
ARFLYNLRRLLGEIEDLPVPTIAAVDGPALGGGLELALACDLRVAGSTVTKIGLPETRLA
IIPGAGGTQRLSRLIGSSRAKDLIFASKILNAGEAERAGVVNYVSAEGQSASEKAEEVVG
EMLQAGPLALRAAKTAIDTGSQLDLESGLDVERLSYQTILQTEDRLEGLKAFAEKRKPVY
KGR