Protein Info for mRNA_7770 in Rhodosporidium toruloides IFO0880

Name: 16138
Annotation: K09250 CNBP cellular nucleic acid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF00098: zf-CCHC" amino acids 12 to 29 (18 residues), 23.7 bits, see alignment (E = 5.8e-09) amino acids 33 to 49 (17 residues), 22.8 bits, see alignment (E = 1.1e-08) amino acids 57 to 73 (17 residues), 30.3 bits, see alignment (E = 4.8e-11) amino acids 85 to 102 (18 residues), 29.4 bits, see alignment (E = 9.4e-11) amino acids 186 to 202 (17 residues), 35.7 bits, see alignment (E = 9e-13) PF14392: zf-CCHC_4" amino acids 12 to 28 (17 residues), 7.8 bits, see alignment (E = 0.00046) amino acids 32 to 48 (17 residues), 11.8 bits, see alignment (E = 2.5e-05) amino acids 58 to 72 (15 residues), 11.9 bits, see alignment (E = 2.3e-05) amino acids 86 to 101 (16 residues), 11.6 bits, see alignment (E = 3e-05) amino acids 160 to 174 (15 residues), 11.4 bits, see alignment (E = 3.4e-05) amino acids 186 to 202 (17 residues), 6.4 bits, see alignment (E = 0.0013)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>mRNA_7770 K09250 CNBP cellular nucleic acid-binding protein (Rhodosporidium toruloides IFO0880)
MAFAQPFPMNRRGCFVCGKPGHIAAACTSTERLCFNCGEPGHESNACPNPKVSDNKQCYS
CGGMGHLAADCPSIRVAATLSAAGPKCYNCQQFGHIARSCPNATVEAGADGVAPVAPVPV
AARPLGARVGGFAPRGGFRGGFMGARGGFMGAQAGGRGRCYGCGGFGHVVATCPTAAAFG
APRGPKTCYKCQQEGHIARDCPLNAVPAETATIA