Protein Info for mRNA_7793 in Rhodosporidium toruloides IFO0880

Name: 16161
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 53 to 71 (19 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details amino acids 393 to 413 (21 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 454 to 477 (24 residues), see Phobius details PF07690: MFS_1" amino acids 62 to 442 (381 residues), 113.3 bits, see alignment E=6.6e-37

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>mRNA_7793 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MSSPPAAGTLEDRKLSYASSTQDSAHDDHGAQTDGELTWTAEEEKRIVRKIDWRLMPLLW
ALFMCVLSFLDRSNIGNANAAGMSKSLKMSSGQYQWLLTIFYIGYALGQPTTLLWKALSP
HVFVAILTLCWGGFALLQAAARWEGLMALRLLLGVAETAFAPGVTFFLSFFYSRREVGFR
QGLYLGAAPIASCYAGALAYGISHIHNSSVPVWKLLFLIEGAPAIPMAAVTYFFLPDRPT
KAKFLTTREKEIARRRTERDGKTGREEGLKMRNVWKGLRDPKAYIPACVFPLSLAHPRLL
TTSARRLCYFSCNVSYSSLPVFLPTILTDMGFTSIRAQGLSAPPYLASFFVVVGVCWLSD
RVGDRTAFLIPLSMLGGIGYLLLALVTSTGVRYFAIFLCASGIFPCIGLLLPLTASMHED
DSKRGAGFLLLNLVGQCGPFLGTRLYPANEGPYYHKGMAICCAFMFFVTLLVSLLRLCVR
SPPPNTHNHQLTQVLLCSILIRENRRRDALYGFVDPKAQGLEYGRSEAYYRQQRVEGEGK
DEEGVGKSEEREKEEEERRWRYLL