Protein Info for mRNA_7826 in Rhodosporidium toruloides IFO0880

Name: 16194
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 417 to 439 (23 residues), see Phobius details PF07690: MFS_1" amino acids 53 to 402 (350 residues), 99.2 bits, see alignment E=1.2e-32

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (523 amino acids)

>mRNA_7826 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MSPAAAHDEGKVVDEKGVGTFEVYENSSLPVTVSAEDDKRIRRKTDFRILVILCLVFWLQ
VLDKNVMGYTATVGLKKDANLKGNEYSTLSSIAPYAQIACQPLGAYLLVRFPINRLLSVL
MFSWAAVLMGMAGATSFATLVATRFLLGAFESLSMPAFTLSTVTWYRRAEQPIRMAAWYC
MNGTASMAGAFFVWALSHAKNPKLHIYQITFLFTGGLTMACVPVAWFFWDEKPEKAKFLS
PEDRLKAVKELFLDPKTYLFATLSILCNTIPFVYNTFGPILLQTLVGFDPKTTLLLNIPF
GVLQILCILLTSWCATRFRIKSLFFALLYLPCIMGYVLLYTLPREDKYVGGLLFGFYSTA
FAFGASPLLVAWIGANTAGSTKKAGLVSIYQACSAAGNVIAPNLFRAPDAPLYLQGLRLV
LILTCITLLNIGLLVCLLKWQNEQKKRQRVARGKPAELTDLSMARTFDENLAHPNPHGIE
EIPRTPATDSASADLKAAPAHVPVQEADDDRTDKENEMFIYVY