Protein Info for mRNA_7835 in Rhodosporidium toruloides IFO0880

Name: 16203
Annotation: K01823 idi, IDI isopentenyl-diphosphate Delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02150: isopentenyl-diphosphate delta-isomerase
  • amino acids 27 to 207 (181 residues), 164.2 bits, E=1.1e-52
• PF00293: NUDIX
  • amino acids 60 to 204 (145 residues), 85.6 bits, E=1.6e-28

Best Hits

Swiss-Prot: 54% identical to IDI1_SCHPO: Isopentenyl-diphosphate Delta-isomerase (idi1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 58% identity to scm:SCHCODRAFT_64487)

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or polyprenyl synthesis (EC 5.3.3.2)

MetaCyc Pathways

• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (10/10 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (7/7 steps found)
• isoprene biosynthesis II (engineered) (7/8 steps found)
• all-trans-farnesol biosynthesis (3/4 steps found)
• mevalonate pathway II (haloarchaea) (5/7 steps found)
• mevalonate pathway IV (archaea) (5/8 steps found)
• bisabolene biosynthesis (engineered) (3/6 steps found)
• mono-trans, poly-cis decaprenyl phosphate biosynthesis (2/5 steps found)
• mevalonate pathway III (Thermoplasma) (4/8 steps found)
• superpathway of ergosterol biosynthesis I (16/26 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (4/12 steps found)
• taxadiene biosynthesis (engineered) (4/13 steps found)
• methylerythritol phosphate pathway I (1/9 steps found)
• methylerythritol phosphate pathway II (1/9 steps found)
• isoprene biosynthesis I (1/10 steps found)
• superpathway of cholesterol biosynthesis (14/38 steps found)
• superpathway of ergosterol biosynthesis II (5/26 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Protein Sequence (252 amino acids)

>mRNA_7835 K01823 idi, IDI isopentenyl-diphosphate Delta-isomerase (Rhodosporidium toruloides IFO0880)
MSSATHTITLDPSKYDQEQINLMEERLILLDNDDRAIGEGSKKDCHLIPPAGSAETRSPL
HRAFSVFLFHPQTGKLLLQRRADEKITFPKMWTNTCCSHPLTSFGEMDEEGQIGVRRAAA
RKLTHELGIPHTYPLDDFAYLTRIHYYAPSDEIWAEHEIDYILFLTLDPKTDVNPNEVSD
VKWVSKADLEEFFKDPSSTFTPWFRLIAESFLYKWWDALLASRKDESQPLDAKALIAEVE
KEKATMGSIIRM