Protein Info for mRNA_7844 in Rhodosporidium toruloides IFO0880

Name: 16212
Annotation: K02966 RP-S19e, RPS19 small subunit ribosomal protein S19e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF01090: Ribosomal_S19e" amino acids 3 to 139 (137 residues), 193.3 bits, see alignment E=7.2e-62

Best Hits

Swiss-Prot: 73% identical to RS19A_SCHPO: 40S ribosomal protein S19-A (rps1901) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02966, small subunit ribosomal protein S19e (inferred from 76% identity to ppl:POSPLDRAFT_118341)

Predicted SEED Role

"SSU ribosomal protein S19e" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>mRNA_7844 K02966 RP-S19e, RPS19 small subunit ribosomal protein S19e (Rhodosporidium toruloides IFO0880)
MPTVRDVTAEAFIAAYSSHLKRSGKLEVPVWVDVVKTGTGKELAPYDQDWYYVRAAAVAR
HIYLRKHVGVGALQKLHGSSVNRGCRPSHHRDGSGSVERKILQSLEKIGVLEKDTARGGR
RISVDGQRDLDRIATAVLEEMRSETDDE