Protein Info for mRNA_7871 in Rhodosporidium toruloides IFO0880

Name: 16239
Annotation: HMMPfam-NADH-ubiquinone oxidoreductase complex I, 21 kDa subunit-PF10785,HMMPfam-C-terminal of NADH-ubiquinone oxidoreductase 21 kDa subunit-PF12853

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 35 to 52 (18 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details PF10785: NADH-u_ox-rdase" amino acids 11 to 97 (87 residues), 104.7 bits, see alignment E=3.4e-34 PF12853: NADH_u_ox_C" amino acids 108 to 167 (60 residues), 62.2 bits, see alignment E=3.9e-21

Best Hits

Swiss-Prot: 47% identical to NUXM_NEUCR: NADH-ubiquinone oxidoreductase 20.9 kDa subunit (nuo20.9) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: None (inferred from 56% identity to cnb:CNBG4250)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>mRNA_7871 HMMPfam-NADH-ubiquinone oxidoreductase complex I, 21 kDa subunit-PF10785,HMMPfam-C-terminal of NADH-ubiquinone oxidoreductase 21 kDa subunit-PF12853 (Rhodosporidium toruloides IFO0880)
MPARDGVNDLNTPYPVVDADPHFSRVMSYMRPSEYAMWAAGTAAFPAAIYGLELADPSRL
GPRGLRPTLKIATWLGFAGGFLLAYQTTSLRLWGWRENEREQARDKEELSQLAKEGKPLY
GESDLPPYIQGVAHRNSLWSQLKFSVMPWFNFVHHPYHGTDPSKYKEES