Protein Info for mRNA_7873 in Rhodosporidium toruloides IFO0880

Name: 16241
Annotation: K10258 TER, TSC13, CER10 very-long-chain enoyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 114 to 131 (18 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details PF02544: Steroid_dh" amino acids 170 to 324 (155 residues), 107.2 bits, see alignment E=4.1e-35

Best Hits

KEGG orthology group: K10258, enoyl reductase [EC: 1.3.1.-] (inferred from 60% identity to uma:UM03622.1)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>mRNA_7873 K10258 TER, TSC13, CER10 very-long-chain enoyl-CoA reductase (Rhodosporidium toruloides IFO0880)
MKPTSTPEGCPHPLPARAMAFTVTVKPRSTKPSKRFPLTVQLDQDPATVGALKSAIASKV
KLDVHRQRITTPDKKLLDDDAKPLGEFGVKSGDTLEIKDLGPQIAWKTVFLTEYFGPLFI
HPAFYFGSKLFYGKTFEHSRMQKVALVLILAHYAKRELETLFVHRFSSATMPWFNIVKNS
GHYWGLSGILLAAPLYGPWNGAARLIGTSRDSESWIYGWAALWAYAELSNLITHLNLASL
RPKGTKVRQIPKGYGFNTISCGNYFFETIAWCAFTGLTLNWASALFTAVAVAQMYVWAVK
KHRRYRKEFGSAYPRNRKAMFPFIA