Protein Info for mRNA_7877 in Rhodosporidium toruloides IFO0880

Name: 16245
Annotation: KOG1575 Voltage-gated shaker-like K+ channel, subunit beta/KCNAB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00248: Aldo_ket_red" amino acids 30 to 341 (312 residues), 227.6 bits, see alignment E=1e-71

Best Hits

Swiss-Prot: 64% identical to AAD4_YEAST: Probable aryl-alcohol dehydrogenase AAD4 (AAD4) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00100, [EC: 1.1.1.-] (inferred from 66% identity to afm:AFUA_2G11250)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>mRNA_7877 KOG1575 Voltage-gated shaker-like K+ channel, subunit beta/KCNAB (Rhodosporidium toruloides IFO0880)
MAARTLAVSATSPLARYRIVGPNCGLRASPLQLGIMSLGKKWEGMLGSVTKEQAFELLDA
FVEAGGNFVDTANLYQGEDSETWFGEWLKERQIRDRLIIATKYTGNYKESALGKKEAILY
GGNSRRSLHVSVRDSLAKLQTDWIDILYVHWWDYTTSIKELMDSLHILVEQGKVLYLGAS
DMPAWVVSAANQYALDHGKTPFSIYQGRWSVMFRDMERDILPMCHQFGLALAPWGAIGSG
RLMTKKQLEDRLASGETIRARGQQAKDKQSDLEIKYSEVLASVAAEHGIESVTAIALAWL
LARAPNVFPIVGGRKVSHLQDNIQALKIKLTKEQIARIDAVQQFDVGFPHNMIGTDPSLE
VIYDPKQSMIASEDIDHLPGPKPFGLA