Protein Info for mRNA_7897 in Rhodosporidium toruloides IFO0880

Name: 16265
Annotation: K10872 DMC1 meiotic recombination protein DMC1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR02238: meiotic recombinase Dmc1" amino acids 11 to 325 (315 residues), 517.9 bits, see alignment E=4.5e-160 PF08423: Rad51" amino acids 71 to 325 (255 residues), 363.1 bits, see alignment E=1.5e-112 PF13481: AAA_25" amino acids 81 to 257 (177 residues), 34.2 bits, see alignment E=3.9e-12 PF00154: RecA" amino acids 82 to 292 (211 residues), 56 bits, see alignment E=9.1e-19 PF06745: ATPase" amino acids 88 to 266 (179 residues), 31 bits, see alignment E=3.5e-11

Best Hits

Swiss-Prot: 66% identical to DMC1_SCHPO: Meiotic recombination protein dmc1 (dmc1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K10872, meiotic recombination protein DMC1 (inferred from 66% identity to spo:SPAC8E11.03c)

Predicted SEED Role

"Meiotic recombination protein DMC1" in subsystem DNA repair and recombination eukaryotic

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>mRNA_7897 K10872 DMC1 meiotic recombination protein DMC1 (Rhodosporidium toruloides IFO0880)
MSTDDSPILDVDALQQQGISAQDIAKLRTAGYATVLGVVQATRKCLTKVKGLSEIKVDKI
KTAANTLCPQTFLTGAECALRREKVIFISTGSASLDALLGGGVQTGSITEVYGEFRTGKT
QLSHTLCVTSQLPVDMGGGEGKVAFIDTEGTFRPDRVKSIAERFGVDPQAALENVVVARA
HNSEHQMELITALAAKFAEEQGAYRLLIVDSILALFRIDYAGRGELSDRQQKLNQMLSRL
TRISEEFQCAIFLTNQVQSSPDASAMFAGGDKKPVGGHVMAHASATRVYLRKGRGEERVA
KLADSPDMPEGEATYKITVGGIMDA