Protein Info for mRNA_7905 in Rhodosporidium toruloides IFO0880

Name: 16273
Annotation: K00147 proA glutamate-5-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF00171: Aldedh" amino acids 9 to 294 (286 residues), 46.9 bits, see alignment E=7.9e-17 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 25 to 425 (401 residues), 482.3 bits, see alignment E=5.2e-149

Best Hits

Swiss-Prot: 56% identical to PROA_SCHPO: Probable gamma-glutamyl phosphate reductase (pro1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 64% identity to scm:SCHCODRAFT_54944)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>mRNA_7905 K00147 proA glutamate-5-semialdehyde dehydrogenase (Rhodosporidium toruloides IFO0880)
MSSNGAAPTAGQVARTAKETFDASQLLDSSERHTALLALKQALTDAKEEILQANRQDIEA
AREQVAAGKMSSSLLKRLDLQSSADKYDSMLQGILDVDSLPDPTGQVTYARKLDEGLDLY
RVTCPIGVLLVIFEARPEVIVNITALAIKSGNAAILKGGKESIHTQNVMTRVIQSALSTT
SLPPAYIQTVSSRSEIASLLSQDRYIDLVIPRGSNSLVRSIQNGTRIPVMGHADGLCAVF
VDESAVEKKAINVVVDSKTTYTAACNAAETLLIHDSLLSSLWPRLASALLDANIQLRCDP
STLSALSSSIFSHPSFSTLVKPSTDEDYETEFLDLILAVKAVPSCAAAISHINNHSSHHT
DAIVTEDEANARAFCRGIDSAGVYVNASTRFADGFRYGFGTEVGVSTGKTHARGPVGLEG
LVIYKYQIKSTAAEGHGTAVFGSGEGKKPFLHTPLPLDKPAY