Protein Info for mRNA_7908 in Rhodosporidium toruloides IFO0880

Name: 16276
Annotation: K03783 punA, PNP purine-nucleoside phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01048: PNP_UDP_1
  • amino acids 62 to 281 (220 residues), 102.9 bits, E=8.7e-34
• TIGR01697: inosine/guanosine/xanthosine phosphorylase family
  • amino acids 62 to 283 (222 residues), 242.4 bits, E=2.4e-76

Predicted SEED Role

"Purine nucleoside phosphorylase (EC 2.4.2.1)" in subsystem Adenosyl nucleosidases or Deoxyribose and Deoxynucleoside Catabolism or Purine conversions (EC 2.4.2.1)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (14/14 steps found)
• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• purine deoxyribonucleosides degradation I (4/4 steps found)
• purine deoxyribonucleosides degradation II (3/3 steps found)
• purine ribonucleosides degradation (5/6 steps found)
• adenine and adenosine salvage I (2/2 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• adenine and adenosine salvage III (3/4 steps found)
• ureide biosynthesis (5/7 steps found)
• adenine and adenosine salvage V (2/3 steps found)
• pyrimidine deoxyribonucleosides degradation (2/3 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)
• xanthine and xanthosine salvage (1/2 steps found)
• superpathway of purine deoxyribonucleosides degradation (4/7 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)
• fluoroacetate and fluorothreonine biosynthesis (1/6 steps found)
• nucleoside and nucleotide degradation (archaea) (3/10 steps found)
• arsenic detoxification (mammals) (8/17 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.1

Protein Sequence (414 amino acids)

>mRNA_7908 K03783 punA, PNP purine-nucleoside phosphorylase (Rhodosporidium toruloides IFO0880)
MPSDLSQDALVPDLSALPRLADPLPSPLHSSHPIDIARLPGSYYSALVAIRERLPKELRT
PKVAIVCGSGLQGLAEVLKDRVLVSYSDIDGFGESTVRGHQSALAFGFLGKNRTPVVCQL
GRLHAYEGHKLEDVVYPIRILRLLGASIAILTNAAGGLNSSLLKVGSIVALVDHISLPSL
TSMNPLIGSNKDQFGPRFPPMSDAYDYPLRLSLFRAAHELGLLEEAKVEETGGVVEGVYA
WVAGPTYETRAEQRFLKAAGADVVGMSTVPEVIAARHAGMRESAILDSLASLSSLRSVAD
YLLRRPAHLFAIPFPLAGVLTLSLCTNMVVATPYRLAAPVAKAENDPAFGANEGLQRVRT
AVGEVLQKEEVANHQEVLDVSARRADDMRTLVERTIERVFGEDAEEHGDIVLRN