Protein Info for mRNA_7911 in Rhodosporidium toruloides IFO0880

Name: 16279
Annotation: K03015 RPB7, POLR2G DNA-directed RNA polymerase II subunit RPB7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03876: SHS2_Rpb7-N
  • amino acids 13 to 82 (70 residues), 36.6 bits, E=7.2e-13
• PF08292: RNA_pol_Rbc25
  • amino acids 84 to 157 (74 residues), 26.7 bits, E=9e-10
• PF00575: S1
  • amino acids 84 to 162 (79 residues), 50 bits, E=4.8e-17

Best Hits

Swiss-Prot: 46% identical to RPB7_DICDI: DNA-directed RNA polymerase II subunit rpb7 (polr2g) from Dictyostelium discoideum

KEGG orthology group: K03015, DNA-directed RNA polymerase II subunit RPB7 (inferred from 54% identity to tml:GSTUM_00010542001)

Predicted SEED Role

"DNA-directed RNA polymerase II 19 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase II (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Protein Sequence (177 amino acids)

>mRNA_7911 K03015 RPB7, POLR2G DNA-directed RNA polymerase II subunit RPB7 (Rhodosporidium toruloides IFO0880)
MFFIKLLTQDLIMHPSYFNQSLRGYLSAELRRQVEGTCSGRLGYIIAVIGEEYENSADKT
HRGRIMEDGQAVFSVKYQAVVYRPFRGEVVDGVVSSVNKMGIFVDVGPLQCFISTHLVPP
DFSFDPNANPPCFASSEDTLTIQKGTKIRLKIVGTRVDATEIFAIGTIKEDYLGPLG