Protein Info for mRNA_7913 in Rhodosporidium toruloides IFO0880

Name: 16281
Annotation: K00234 SDHA, SDH1 succinate dehydrogenase (ubiquinone) flavoprotein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01816: succinate dehydrogenase, flavoprotein subunit
  • amino acids 49 to 635 (587 residues), 994.3 bits, E=1.5e-303
• PF00890: FAD_binding_2
  • amino acids 52 to 447 (396 residues), 418.6 bits, E=4.9e-129
• TIGR01812: succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  • amino acids 52 to 623 (572 residues), 797 bits, E=9.4e-244
• PF02910: Succ_DH_flav_C
  • amino acids 502 to 631 (130 residues), 148 bits, E=2.2e-47

Best Hits

Swiss-Prot: 78% identical to SDHA_SCHPO: Probable succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (sdh1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00234, succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC: 1.3.5.1] (inferred from 84% identity to scm:SCHCODRAFT_74617)

MetaCyc: 74% identical to succinate dehydrogenase flavoprotein (Saccharomyces cerevisiae)

Predicted SEED Role

"Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/25 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (13/14 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• succinate to cytochrome bd oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• succinate to plastoquinol oxidase (1/2 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• succinate to chytochrome c oxidase via cytochrome c₆ (1/3 steps found)
• succinate to cytochrome c oxidase via plastocyanin (1/3 steps found)
• methylaspartate cycle (9/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.5.1, 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Protein Sequence (717 amino acids)

>mRNA_7913 K00234 SDHA, SDH1 succinate dehydrogenase (ubiquinone) flavoprotein subunit (Rhodosporidium toruloides IFO0880)
MLSLASRAQRATPSLRAFSTSAPRARVVATQPVRAKETTVSGKYPLIEHEYDAIVVGAGG
AGLRAAFGLAESGLKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSD
WLGDQDAIHYMCREAPNSVLELEHYGLPFSRTKDGKIYQRAFGGQSLKFGKGGQAYRCAA
AADRTGHAMLHTLYGQSLRHNTEYFIEYFATDLIMEDGECVGVMAYNQEDGTMHRFRAHK
TVLATGGYGRAYFSCTSAHTCSGDGAGMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTVEIREGRGVGPEKDHIYLQLSHL
PPDILHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTVGENGEDK
VVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAKHIASTLEPGKPHKKISDNAGI
ESIQALDQIRTSNGPKHTSEIRLDMQKAMQADAAVFRTQDSLENGVKELERVRSTWKDLG
IKDRSMIWNSDLVEALELRNLLTCADQTIVSAEARKESRGAHAREDFQERDDENWMKHTL
SFQKDVEGKTRLAYRNVVHDTLDQNEMKTIPPFKRTCASWRFSSHLQLLTRSLSRRLNGS
FRRCVVDGGGLYGGWTLSHLSFPFSRFILSFLSTHLFDHFTPAVLSAKNRISTVVRG