Protein Info for mRNA_7919 in Rhodosporidium toruloides IFO0880

Name: 16287
Annotation: K01489 cdd, CDA cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 14 to 109 (96 residues), 52.2 bits, E=4.9e-18
• PF08211: dCMP_cyt_deam_2
  • amino acids 14 to 78 (65 residues), 33 bits, E=6.6e-12
• TIGR01354: cytidine deaminase
  • amino acids 16 to 161 (146 residues), 132.3 bits, E=6e-43

Best Hits

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 60% identity to cci:CC1G_03988)

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• pyrimidine ribonucleosides salvage I (3/3 steps found)
• pyrimidine deoxyribonucleosides degradation (2/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• pyrimidine ribonucleosides degradation (1/2 steps found)
• pyrimidine ribonucleosides salvage II (1/2 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
• pyrimidine deoxyribonucleosides salvage (2/5 steps found)
• superpathway of pyrimidine ribonucleosides degradation (2/5 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Protein Sequence (173 amino acids)

>mRNA_7919 K01489 cdd, CDA cytidine deaminase (Rhodosporidium toruloides IFO0880)
MVAYNPLPLSPSDRKTLISSALSARDGSYSPYSNFRVGACLLTDEGEFVRGANVECASYG
GAICAERTAIVKGVSEGKRRFVALAVTSDVNGMVSPCGICRQVLREFCPLEMPVLLIPSS
YVEGKTPTKSATEAEGADTEDTVVETTMGELLPLSFGPEDLRKPRPGAGEGKA