Protein Info for mRNA_8042 in Rhodosporidium toruloides IFO0880

Name: 16410
Annotation: K17408 DAP3, MRPS29 small subunit ribosomal protein S29

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 326 to 344 (19 residues), see Phobius details PF10236: DAP3" amino acids 127 to 435 (309 residues), 190.2 bits, see alignment E=5.5e-60 PF13191: AAA_16" amino acids 128 to 289 (162 residues), 35.5 bits, see alignment E=1.4e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>mRNA_8042 K17408 DAP3, MRPS29 small subunit ribosomal protein S29 (Rhodosporidium toruloides IFO0880)
MSGRPAVASMLRTVPQARTFSSTSATLAPPLPGSKGAMYARNKRAIFGKGDEEAEGTRAA
ARSGLQEVMMRPPDLNHLDALDPDAVEPRAVGQPKAYPEPVIKALKAYQLPRPIERFHRL
TPRPAAVVRDATVQIAQALDEASKASSREMRYLLAGPEGVGKSILLLQAASYAQSKGWVV
LYIPEATRLVDSSAPYSYSSNLALFEQPTLALDLLNRWSSGNAEAFKSLKTSKEWAFGDV
KVPQGKPLADLARVAGRDEKIPTLVLEAVMEELSAQQQKPVLLAADECEGLFVRTKYVDP
SYRKLEPYHLVIPRMLLDYMAGLRKFASGAVVFAYSSAGLALAPALQDFVKPRVDSTRLD
PYPSIYDRAGSPNYPIYQEVLRSGVHRFDVPTRLSKEEAAGIVELVRAFRGNRKAVDDKA
FLEHYLTADANAGLFFRALSQNPII