Protein Info for mRNA_8043 in Rhodosporidium toruloides IFO0880

Name: 16411
Annotation: K15283 SLC35E1 solute carrier family 35, member E1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 transmembrane" amino acids 120 to 142 (23 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 367 to 385 (19 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details amino acids 466 to 486 (21 residues), see Phobius details PF03151: TPT" amino acids 134 to 484 (351 residues), 180.8 bits, see alignment E=4e-57

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (708 amino acids)

>mRNA_8043 K15283 SLC35E1 solute carrier family 35, member E1 (Rhodosporidium toruloides IFO0880)
MDAPRHRQSHGSQAYPADNPYGAYNPPAVADNGFAQNGYHAANGGGYRPRSPAVFSTGDE
GTLSAFLSTLIRSAQSTFAGNGGGSGGSQSLGGSLSSLLPKAPSNSTLTSSSHRRSLSVS
VTSLVPSSSTLGFVFLCCLWYLSSAFSSNTGKSILTRFRYPVTLTFIQFAFVAGYCVVVL
SLREQLGSRAAGHHHSHHGAGLSKRRGSLATLGAWGIRRPSRHMFNGTFMMSLFQIAGHV
FSSMAIARVPVSTVHTIKALSPLFTVLSYAALFGVRYSSATYVALLPLTVGVMLACSFDL
RANAVGFLCALGSTFIFVAQNIFSKKLLPKENAAVSAEEKSQGVGAGSGGSSGGGAGGHA
KLDKLNLLFYSSGMAFILMIPIWLYSDASALFFGPAAVATNAQQPATSTSELVFFFFANG
TVHFAQNLLAFSLLARTSPVTYSIASLVKRIAVICIAIVWSGQHVSFIQAVGMTSTFVGL
WMYNSAKTDVDKGEKRRTQVEKRMELSLPQTVGDARDLDGGITPPPPSNLHAQAYGNPLS
PTQKAPSYSVAIGASSAGDPRSPTLANGFTSGSQPHPAPAPPPPHSHAYQAQHTHAPSQN
PFSSQHPAPTAPSYASPPLHQNGFAPAPPATNSTNYFSASASSTAPITNGASGPRNRQAS
SSVSRDSSPAAMKTGGHHHPAMGGIQPVPTSFFGGGGTAAAGGAGQLR