Protein Info for mRNA_8060 in Rhodosporidium toruloides IFO0880

Name: 16428
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 145 to 166 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details amino acids 467 to 487 (21 residues), see Phobius details amino acids 495 to 519 (25 residues), see Phobius details amino acids 528 to 550 (23 residues), see Phobius details amino acids 561 to 581 (21 residues), see Phobius details PF07690: MFS_1" amino acids 159 to 543 (385 residues), 116.3 bits, see alignment E=1.6e-37 PF00083: Sugar_tr" amino acids 187 to 401 (215 residues), 43.2 bits, see alignment E=2.7e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (598 amino acids)

>mRNA_8060 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MATHQPDTAATQPGLPVLAQPVVDSSLVSPPPAAPPAESSTTARKQSIPSSRSSHSGETL
AEQDAVDLEKGENKEDRTFNDQEDEVDAPPKPDPATAAKGKEDPSGCVLRLSHVVSRELT
PRNSGDPFLVTLKGREHLSPHTWSVWYRWALTALAGFLVLNATFASSAPSNLIPSIIGHF
HVSQEVGILLIAIFVAGYCVGPLLWGPLSERYGRRLVFLVVWPPYIGFQIGCALAPNIGS
LIVFRFLGGCFAASPLTNSGGVIADLWDAERRGDAMAIFALMPFAGPALAPIISGFMQVT
GTNWRWIFWVLTAFAGLCGILLVAFLPETYLPVILQAEARRLRKETGDSRYHAELDIKKE
GGIKATLQRTVLKPFVMAVEEPMLLILTVYMYVTPLVYGVVYLLFEAIPIVFEGKHGLNG
GESGLVFLALLTGGVIGVLGYIFYFNPQYMKKHRAIRPKMVPPEERLKPMLIASPLFAAA
FFWFGWTGAYPHISIWSPILAIVMLGTTILYVFLTGFNYLIDTYLWGASSALAFNTVVRS
SFGAGFPLFAVQMYNKLGIQGASSLLGGLAILFIPAPFLLIKYGKKIRSWSKNAVVLD