Protein Info for mRNA_8062 in Rhodosporidium toruloides IFO0880

Name: 16430
Annotation: KOG1441 Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 59 to 81 (23 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details PF03151: TPT" amino acids 62 to 259 (198 residues), 56.2 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: None (inferred from 54% identity to lbc:LACBIDRAFT_249948)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>mRNA_8062 KOG1441 Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter (Rhodosporidium toruloides IFO0880)
MSGAPDVKLPVYPSDNNDPLSSKGLLNERDEGLPTAVTNATSAKTAASMASAEGIKKIWP
GYIIMVWIALSSGVILQNAYILRTLQFNYPIALTTWHLVYATIGTRLLLRFTHLLDDLHK
VQMSWDRWLRNIVPIGALFSGSLIFSNFAYLSLSVSFIQMLKAFTSVAVLGMSVLFGLEQ
MQPRKFVIVIAISCGVALASYGEIAFDMGGFICQALGIAFESARLVSIQLLMSGLKMGPL
VSLYYFAPVCAGLNMMLIPFFEGAAPFQDALEVVGLPILVGNATTAFALNVAVVFLIGCA
SSLVLTLSGVIKDILLVLGSVVGLREGGGRGGGAGLRRLG