Protein Info for mRNA_8086 in Rhodosporidium toruloides IFO0880

Name: 16454
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 28 to 53 (26 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 121 to 122 (2 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 158 to 174 (17 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 366 to 392 (27 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details amino acids 451 to 473 (23 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 417 (382 residues), 150.4 bits, see alignment E=6.7e-48

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>mRNA_8086 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MENGVPIVRLRGPDDPLSPLNFSKARKWLIVTIVTSGAFCITCCSSMIAFTYPGVEREFH
VSAEVATLGLSLFVLGMGIFPLLVGPLSEWYGRSPVYFIGFAVYIAFNFGVAFANNIATL
LICRFLSGAFASSFLSVAGGTVADLFRPQETGAPMSAYTAGPFLGPVAGPIISGFINQNL
DWRWTWYILLIWSAVEFVALLVFVPETYLQAILKKKAQRLRKAGRTDVRAPVEVDERSIA
TVIIVSCYKPFQILATEPMALALCTWTALLLGILYAFFSAFNIVYGREGYGFEMQIVGLT
YIPIGIGIVAGALCHPIWARYYRLKATQLGRRPPPEEHLRKGLWGVCLVPISLFWFAFTT
YTSVHWIVSLIATVPFGVGLVWSFQAVFVYLVDAFRPVAASAMAANSAMRSSFAAAFPLF
TIQMFHRLGRSSSFLLLSPQTDPLARSSAGAQYALMLTALLCLAMVPFPFLFFKLGHKYR
RGSKFANTED