Protein Info for mRNA_8092 in Rhodosporidium toruloides IFO0880

Name: 16460
Annotation: K14457 MOGAT2, MGAT2 2-acylglycerol O-acyltransferase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 265 to 280 (16 residues), see Phobius details PF03982: DAGAT" amino acids 57 to 345 (289 residues), 343 bits, see alignment E=6e-107

Best Hits

Swiss-Prot: 52% identical to DGT2B_UMBRA: Diacylglycerol O-acyltransferase 2B (DGAT2B) from Umbelopsis ramanniana

KEGG orthology group: K14457, 2-acylglycerol O-acyltransferase 2 [EC: 2.3.1.22] (inferred from 65% identity to uma:UM03937.1)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>mRNA_8092 K14457 MOGAT2, MGAT2 2-acylglycerol O-acyltransferase 2 (Rhodosporidium toruloides IFO0880)
MGQQATLEELYTRSEISKIKFAPFGVPRSRRLQTFSVFAWTTALPILLGVFFLLCSFPPL
WPAVIAYLTWVFFIDQAPTHGGRAQSWLRKSRIWVWFAGYYPVSLIKSADLPPDRKYVFG
YHPHGVIGMGAIANFATDATGFSTLFPGLNPHLLTLQSNFKLPLYRELLLALGICSVSMK
SCQNILRQGPGSALTIVVGGAAESLSAHPGTADLTLKRRKGFIKLAIRQGADLVPVFSFG
ENDIFGQLRNERGTRLYKLQKRFQGVFGFTLPLFYGRGLFNYNVGLMPYRHPIVSVVGRP
ISVQQKDHPTTADLEEVQARYIAELKRIWEDYKDAYAKSRTRELNIIA