Protein Info for mRNA_8110 in Rhodosporidium toruloides IFO0880

Name: 16478
Annotation: HMMPfam-G protein-coupled glucose receptor regulating Gpa2-PF11710,SUPERFAMILY--SSF81321

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details PF11710: Git3" amino acids 10 to 196 (187 residues), 30.5 bits, see alignment E=1.5e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>mRNA_8110 HMMPfam-G protein-coupled glucose receptor regulating Gpa2-PF11710,SUPERFAMILY--SSF81321 (Rhodosporidium toruloides IFO0880)
MPALPADSWQNIVSVVFSALSTLGALAIISGFVLSPQRQHLRLKLILGLGITDFVQAVTT
LSGNALELAGHPYKTNSNSCLGSAFVYQACVLCNACWTLVIAMVTYTTLTHPFSRLTTLL
EHRLAFPAITAGVLVVGLTPAIATTAVYDMADAAGVCFMKPGTQAGNLVLFVPRAATLAA
VICLYLALFIFFRRRNMKLLDMSSNDEEGEEHDARASKRMSLSSLRGRLSVWSRRQSEVE
NGGMRMTEKPAHRPLATIPGSPVAFSQPFDDSAPSSQPFPKLDNTSPPPPHHRSDVHLPC
REVRQSSSVTQVDLDEALHDTEQRSPNEVASPSIPRFKRFSSHVFSVQQSASGNATPERA
AYRPLSPRQLNKRLSLLMALYPLAYSCLVAVSIARLIQQLATKQTPSAGLLWTSRYLIFS
QGLVDGVLYVVVQLAFRAWTRRAQGGGSGGTGTGQGRGTV