Protein Info for mRNA_8111 in Rhodosporidium toruloides IFO0880

Name: 16479
Annotation: HMMPfam-CTD kinase subunit gamma CTK3-PF12243,HMMPfam-CTD kinase subunit gamma CTK3 C-terminus-PF12350,ProSiteProfiles-CID domain profile.-PS51391

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12243: CTK3
  • amino acids 1 to 134 (134 residues), 101.6 bits, E=3.2e-33
• PF12350: CTK3_C
  • amino acids 166 to 281 (116 residues), 59.9 bits, E=2.2e-20

Predicted SEED Role

No annotation

Protein Sequence (333 amino acids)

>mRNA_8111 HMMPfam-CTD kinase subunit gamma CTK3-PF12243,HMMPfam-CTD kinase subunit gamma CTK3 C-terminus-PF12350,ProSiteProfiles-CID domain profile.-PS51391 (Rhodosporidium toruloides IFO0880)
MDPFEVRMEFISLVSKLTSSVLSISKVASFALKHAAKCSDDIWDCYVDEIAHANLNARVN
LLYLLDALLDKEGPKAVSRGAGAGAVGLGSYRVLVERDLGKVVGHVVPETREGILNWMSV
QQVLRSWKTRRLLDAEVLEQVTEELENRKAALHDASADSSALANFSKNDILRRIEDDRER
HKRLKERIWVLPVPSTIFSLPLSSSIPAAAASSAATSSQKPSPISPASPFDPTSSAKPKS
SHARKSSIAAAAAEKATPAAATRGPELALEIEFEQLWEANEEERRAVQGGEAGDSEMADA
ARPWKRSKVWPLDEHERQELRRERQRCFVIEAA