Protein Info for mRNA_8116 in Rhodosporidium toruloides IFO0880

Name: 16484
Annotation: K00949 thiN, TPK1, THI80 thiamine pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01378: thiamine pyrophosphokinase
  • amino acids 33 to 273 (241 residues), 111.6 bits, E=1.7e-36
• PF04263: TPK_catalytic
  • amino acids 46 to 176 (131 residues), 102.8 bits, E=1.3e-33
• PF04265: TPK_B1_binding
  • amino acids 200 to 270 (71 residues), 59.5 bits, E=2.1e-20

Predicted SEED Role

"Thiamin pyrophosphokinase (EC 2.7.6.2)" in subsystem PnuC-like transporters or Thiamin biosynthesis (EC 2.7.6.2)

MetaCyc Pathways

• thiamine diphosphate salvage III (1/1 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (2/7 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.2

Protein Sequence (280 amino acids)

>mRNA_8116 K00949 thiN, TPK1, THI80 thiamine pyrophosphokinase (Rhodosporidium toruloides IFO0880)
MTDATLWDTHSLLSSSHNTASSTSSPPPPRNALIILNSPLPPQPLFRRLWDAASLRFCAD
GGANRLFDRFVRGKDRAEDGWDDELDGDERKWLPDLVLGDLDSLREDARRYYEGKGVRVE
QDPDEYSTDLGKTVARLSSLESSSPSQAPYQLIIVGGLSGRLDQTVHTLHALTLLAEKEG
RERVWTVGRESAAVVLKKGKHHLKLDLSLFGRTCGILPLGTSSAYVTTTGLEWNLGPNDH
MYPTSLSTAVSTSNHLVKEDVTVETDVAVIWTMEVRGGAE