Protein Info for mRNA_8157 in Rhodosporidium toruloides IFO0880

Name: 16525
Annotation: ProSiteProfiles-DOMON domain profile.-PS50836,ProSiteProfiles-Cytochrome b561 domain profile.-PS50939,SMART-Cytochrome b-561 / ferric reductase transmembrane domain.-SM00665,SUPERFAMILY--SSF49344

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 70 (19 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details PF16010: CDH-cyt" amino acids 76 to 220 (145 residues), 33.2 bits, see alignment E=2.2e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>mRNA_8157 ProSiteProfiles-DOMON domain profile.-PS50836,ProSiteProfiles-Cytochrome b561 domain profile.-PS50939,SMART-Cytochrome b-561 / ferric reductase transmembrane domain.-SM00665,SUPERFAMILY--SSF49344 (Rhodosporidium toruloides IFO0880)
MCPSRGPATRRLLTLLSTLFLLASPVLAAVSSSDLLTYLGGAATGQTLKTAAYTLTMAAN
ASSVLVSCAYKGKVSELGWMGWGTGSAMSDADILVLWPNSDGSWTLSHRTAATTVMPTLV
GTANKDPSTDSSGSVKVVASLSSKSQTDSPAVVTFVRPLQLPATYKGKGEYYQLKKAINQ
QVIYAYGMKNPGSSAQDATLTQHPLDGMGATYVDLSATFSATSAAIEAPLSPVKGGSSSG
SSAAGGTSAATATAGAASGSSSGAASASAATNVATNGAGSTSGAASPLPSTDPTSSSGST
TDTPGGTAWTYAAVIKMHGICAGATWAILAPLGVLFARYARGPPGTTLTRFPWHFYMQGL
VVGPLTLVAVGLAIWAVSLKGGSDEAIYAHKAVGFGIAAGVVLQDLLGMWTHLSHAPARH
GRPPPRALKAWLHMLLGVTLIIAGFVQVNLGLERYGITDGAIRWAYFGCLGVWVLAYFGS
LAVSLASPASRPPPPPHHHRHRRKKRRPVVRKRRRKKKRRRRYDSSSTEDEYDSDDSSSS
GSSTSSSESSSTSSGRSRRR