Protein Info for mRNA_8187 in Rhodosporidium toruloides IFO0880

Name: 16555
Annotation: K10949 KDELR ER lumen protein retaining receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details PF00810: ER_lumen_recept" amino acids 28 to 170 (143 residues), 187.2 bits, see alignment E=3.1e-59

Best Hits

Swiss-Prot: 61% identical to ERD2_DROME: ER lumen protein-retaining receptor (KdelR) from Drosophila melanogaster

KEGG orthology group: K10949, ER lumen protein retaining receptor (inferred from 76% identity to scm:SCHCODRAFT_16594)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>mRNA_8187 K10949 KDELR ER lumen protein retaining receptor (Rhodosporidium toruloides IFO0880)
MNIFRLLGDLSHLASIFILLNKIQKSRSARGISFKTQLIYLIVFLTRYLDLLTGPYISLY
NTIMKLFFIGSSAYVLYLMKVKFRPTQDPAIDTLRLEYLLGPCAVLALIFNYSFTPMEIL
WAFSIYLEAVGILPQLFMLQRTGEAENITTHYLFALGAYRALYIPNWVYRRYFTEDTVDP
IAVCAGIVQTALYSDFFYLFVTKVMRGQKFELPA