Protein Info for mRNA_8207 in Rhodosporidium toruloides IFO0880

Name: 16575
Annotation: K09578 PIN1 peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF13616: Rotamase_3" amino acids 68 to 180 (113 residues), 66.5 bits, see alignment E=4.7e-22 PF00639: Rotamase" amino acids 77 to 183 (107 residues), 70.3 bits, see alignment E=3.5e-23 PF13145: Rotamase_2" amino acids 115 to 181 (67 residues), 27.1 bits, see alignment E=9.9e-10

Best Hits

KEGG orthology group: K09578, peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC: 5.2.1.8] (inferred from 58% identity to uma:UM06003.1)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>mRNA_8207 K09578 PIN1 peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (Rhodosporidium toruloides IFO0880)
MASEDQSWEIRFSNSRKRPYFYNTATQGSRWEVPDSLASSDLSSLPGAEHLKQNQSSSTS
AGASASSDNGGKIRASHLLVKHSGSRRPASWRQANITRSKDEALEILKGHEKTLREADDL
QATFAKLASTESDCSSARDGGDLGFFGRNQMQKPFEDAAFALEVGQLSDIVSTDSGVHVI
LRTA