Protein Info for mRNA_8245 in Rhodosporidium toruloides IFO0880

Name: 16613
Annotation: HMMPfam-Mitochondrial carrier protein-PF00153,ProSiteProfiles-Solute carrier (Solcar) repeat profile.-PS50920,SUPERFAMILY--SSF103506

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 81 to 98 (18 residues), see Phobius details amino acids 135 to 144 (10 residues), see Phobius details amino acids 212 to 236 (25 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details PF00153: Mito_carr" amino acids 5 to 103 (99 residues), 65.7 bits, see alignment E=1.5e-22 amino acids 129 to 246 (118 residues), 49.5 bits, see alignment E=1.7e-17 amino acids 251 to 338 (88 residues), 64.2 bits, see alignment E=4.5e-22

Best Hits

KEGG orthology group: None (inferred from 42% identity to uma:UM04444.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>mRNA_8245 HMMPfam-Mitochondrial carrier protein-PF00153,ProSiteProfiles-Solute carrier (Solcar) repeat profile.-PS50920,SUPERFAMILY--SSF103506 (Rhodosporidium toruloides IFO0880)
MTSSLPPLAQAGSGSLGAVVSNALVFPLDTLTTRLQTSKRSAKKAGSASRAGSYNSLSAA
VQTIYRHEGLSAFYSGLGPDSLSTALSQFLYFLAYSALRDRFQARKARQHPPTAAGKDGK
KSSGPPLLSALEELAIGCLAGIFAKGVVSPLSMITVRAQTSSEPRQEVVGGKEGDKRAVE
SDDSGDEDDGGYGRASSALAIGKEIYQEQGLWGFWSGFGSTVILSINPAITFYGFAALKR
LLPKKNREHPTPAQTFLCGALASAIASALTYPLILAKTRMQFKSPTGRALYRSQFDVFRK
TIAKQGVAGLYQGVESQLLKGFFSEGVKLLVKDRIELLIVLVHRLLVQQGKIPA