Protein Info for mRNA_8272 in Rhodosporidium toruloides IFO0880

Name: 16640
Annotation: K07750 E1.14.13.72, SC4MOL, ERG25 methylsterol monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 50 to 74 (25 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 155 to 292 (138 residues), 90.9 bits, see alignment E=4.8e-30

Best Hits

Swiss-Prot: 57% identical to MSMO_SCHPO: Methylsterol monooxygenase (erg25) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K07750, methylsterol monooxygenase [EC: 1.14.13.72] (inferred from 58% identity to scm:SCHCODRAFT_257479)

MetaCyc: 55% identical to sterol C4-methyl monooxygenase (Saccharomyces cerevisiae)
RXN-13709 [EC: 1.14.18.9]; 1.14.18.9 [EC: 1.14.18.9]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.72 or 1.14.18.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>mRNA_8272 K07750 E1.14.13.72, SC4MOL, ERG25 methylsterol monooxygenase (Rhodosporidium toruloides IFO0880)
MATVFEQAINNGTVLVRDFIKSTQQNDVAGLYAGVNPAQLNWLELAWMNWYSWVGNTTLA
TGIMSFVMHEVVYFGRCLPWMIIDYMGWFKQYKLQADKVPSAKQQWECTKEVLKTHFSVE
LPQIYLFHPMAVAVGMKTWEVPFPSFFGQIVPQVMLFFFMEDFWHYTVHRIMHHRALYKH
VHKVHHTYSAPFGLAAEYAHPIEVLVLGLGTVGGPLLWCYLSGGNMHLITMYTWICCRLF
QAVDAHSGYDFPWSLNHWLPIWAGAEHHDYHHEKFNECFSSSLRVWDWLLGTDQKYHAYR
KAQAEAKTAKKAQ