Protein Info for mRNA_8275 in Rhodosporidium toruloides IFO0880

Name: 16643
Annotation: K00102 dld, LDHD D-lactate dehydrogenase (cytochrome)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 PF01565: FAD_binding_4" amino acids 133 to 264 (132 residues), 109.2 bits, see alignment E=1.4e-35 PF02913: FAD-oxidase_C" amino acids 315 to 566 (252 residues), 187.7 bits, see alignment E=3.1e-59

Best Hits

KEGG orthology group: None (inferred from 60% identity to uma:UM01314.1)

Predicted SEED Role

"D-2-hydroxyglutarate dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>mRNA_8275 K00102 dld, LDHD D-lactate dehydrogenase (cytochrome) (Rhodosporidium toruloides IFO0880)
MAARPTAVQATARALRRTVQPTARAAVAAASSSVRILASNRRYLPSSSSASLAHGRAFST
TPARSAERPARRPDFKKLDADDVAYFKSVLSSPSSLVTTIPSPDGSWQTASEDDLVGYNV
DWMDKYKGNSPVLLKPKTTDEVSKILAYCYKKRIAVVPQGGNTGLVGGGVPLYDELILST
EGMNQVRAFDDVSGILTADAGCILENLSTFLHPKGYMMPLDLGAKGSCHIGGNVATNAGG
LRLLRYGSLHGTVLGIEAVLPDEKGTVLSVNIPGGDGAGALRKDNTGYDLKQLFIGSEGT
LGVITGVSILTPRLPSAINVAVLSVPDFKSVQTVFKETRAQLGEILSAFEFFDQEGLEMV
LHHTGAKSPFETEPENGRAFYVLIETSGSNKDHDDEKLGGLLESLLENETITDGTLAQDE
TQVQSLWSLRESLPEAAGKMGRVYKYDLSMPVKDMYSLVEEARERFKEKGLDKDGSIKTT
VGYGHIGDGNLHINIVAKDWDEKVEKVIEPWIYEATSKRNGSISAEHGVGIMKSRALHYS
KTEAAIGVMQQIRRLFDPRGILMPSKYLPMESDAPFEQEKKEHVGAEQ