Protein Info for mRNA_8291 in Rhodosporidium toruloides IFO0880

Name: 16659
Annotation: K00851 E2.7.1.12, gntK, idnK gluconokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01202: SKI
  • amino acids 14 to 56 (43 residues), 26.3 bits, 3.8e-10

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

• D-gluconate degradation (1/1 steps found)
• sorbitol biosynthesis II (2/3 steps found)
• L-idonate degradation (1/3 steps found)
• ketogluconate metabolism (1/8 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Protein Sequence (255 amino acids)

>mRNA_8291 K00851 E2.7.1.12, gntK, idnK gluconokinase (Rhodosporidium toruloides IFO0880)
MAPLPALIIVMGASGCGKSTVGLGVATALGVPFVDGDDLHPAASVAKMSAGNPLTDEDRI
PWLHKIRETAILLTSPEGLAALDRPAAPPSPSEVDSAALSHELHAAISRIQAPSLNARLE
LRQRGEKREREAVVVACSALTVQYRNLLRGEEARFVLPNGKEITADKHLDPHIETFFIYL
QGTRPLLLNRMEHRAGHFMKASMLDSQLATLQEPHETDEVNVAVVKLGQGEGEAEERGKE
AVIADAVARTRRFVG