Protein Info for mRNA_8323 in Rhodosporidium toruloides IFO0880

Name: 16691
Annotation: HMMPfam-Abscisic acid G-protein coupled receptor-PF12430,HMMPfam-Protein of unknown function (DUF3735)-PF12537

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 386 to 411 (26 residues), see Phobius details amino acids 454 to 472 (19 residues), see Phobius details amino acids 490 to 514 (25 residues), see Phobius details amino acids 534 to 553 (20 residues), see Phobius details PF12537: GPHR_N" amino acids 241 to 310 (70 residues), 59 bits, see alignment E=4e-20 PF12430: ABA_GPCR" amino acids 379 to 558 (180 residues), 140.6 bits, see alignment E=5e-45

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>mRNA_8323 HMMPfam-Abscisic acid G-protein coupled receptor-PF12430,HMMPfam-Protein of unknown function (DUF3735)-PF12537 (Rhodosporidium toruloides IFO0880)
MDGLPPDTAPVPSIALETVLLSAARLAYFAACRLYVNKSLFADLREVIREDGLSSDVDTP
NGEGIELDEAEGGHLGLSGNGGGAGAGGKSSFASRLREDGLGAALSKRTSASAAVPDRRD
SLSPGQTGVSTAGRAYTRLSKALFCLAFSESCMLFTLLLFGDAVSDRARHYNWSISLLAL
LSIIVFVIPFVLCLLVTHRSRTTVTRTLLLTLPPFALYLFFFYNVGSLIADKLVTEGSHT
FGLVNSLLSRLCVPGVVLIASLSGGGALNSAWEAYEWRSVSSAEPVTDAHMAQAERALHR
ARVDLQQRYRSLALAQGSAAREADTASSRSLLSKWTTSNPAALHLKSVEVEVAAMEKMER
QMSQDVSRLRRRKAMREMGRSFKGRVWLLVGWLFSVYCVWKIFVSVINLIFGYTRQSHQH
TSAEGAPAPQGTDLLTSLLTRLAVVLNIELDVATWSRLIGLALIGGILLANMRNVLGGVS
RIFKATSAGISASFMLLFLAQLMAIYLLTSLISLPSSPTASTTSLLDTLPDFNVFSRLFD
SVFLISAAAIFFSRWISRKFRDDAGLAAQYSV