Protein Info for mRNA_8354 in Rhodosporidium toruloides IFO0880

Name: 16722
Annotation: K07734 paiB transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF04299: FMN_bind_2" amino acids 1 to 201 (201 residues), 193.6 bits, see alignment E=1.1e-61

Best Hits

Swiss-Prot: 51% identical to Y0679_EMENI: Uncharacterized protein AN0679 (AN10108) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K07734, transcriptional regulator (inferred from 50% identity to cpw:CPC735_045610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>mRNA_8354 K07734 paiB transcriptional regulator (Rhodosporidium toruloides IFO0880)
MHIPAKHAERSMRAMRTLIRQNPLGFLTTGLSHPDYPFLQSSHIPFILIAPEDESSTELG
VLRAHMARANPQAKAMIASAKMDPSSGTYALEQEVLVLFTADPHGYVSPSWYTETKPATG
KVVPTWDYCAVQVYGKATIFADAADERTSEYLQGQMEALTELSEASVGKTGDGAWKVSDA
PERYIELHKKAVVGVEIRIDRIEGRSKMSQDKSPKDVEGVVAGFRSLRTEAGEKMAQGVR
RAADEATAAKAAE