Protein Info for mRNA_8360 in Rhodosporidium toruloides IFO0880

Name: 16728
Annotation: K02739 PSMB7 20S proteasome subunit beta 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF00227: Proteasome" amino acids 84 to 286 (203 residues), 152.4 bits, see alignment E=1.1e-48 PF12465: Pr_beta_C" amino acids 310 to 344 (35 residues), 45.6 bits, see alignment 3.8e-16

Best Hits

Predicted SEED Role

"proteasome subunit beta2 (EC 3.4.25.1)" in subsystem Proteasome eukaryotic (EC 3.4.25.1)

Isozymes

Compare fitness of predicted isozymes for: 3.4.25.1

Use Curated BLAST to search for 3.4.25.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>mRNA_8360 K02739 PSMB7 20S proteasome subunit beta 2 (Rhodosporidium toruloides IFO0880)
MRAGNEEERSEDGTRFGGDTVGRRGESAQPSPPRHLSILTHRFTLSHSLGMAALTDSNAG
FSFENALRNRVLGQRNLHLPKATSTGTTIVGVVYESGIVLGADTRATEGPIVADKNCEKI
HYISEHIRCCGAGTAADTEFTTNMISSNIKLHELSTGRPPLVATAMTMLKQYLFQFVSPH
RPLRSINQRIDESGLYRYQGQVGAALVLGGIDPTGPHLYTVAPHGSTDKLPYVTMGSGSL
AAMAVFETYWKPNMTRQEAIDVVSEAIEAGIWNDLGSGSNVDVCVIEGEQVEGKYTGKAK
TDYLRNYRTPNEKVTKERNYKWRRGVTAWTKEEVKKLIVAEEVVPLSGGLATGPEGSGAG
ASEMEVDA