Protein Info for mRNA_8386 in Rhodosporidium toruloides IFO0880

Name: 16754
Annotation: K02868 RP-L11e, RPL11 large subunit ribosomal protein L11e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF00281: Ribosomal_L5" amino acids 10 to 63 (54 residues), 74.1 bits, see alignment E=9.4e-25 PF00673: Ribosomal_L5_C" amino acids 67 to 154 (88 residues), 76 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 84% identical to RL11_ASHGO: 60S ribosomal protein L11 (RPL11) from Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)

KEGG orthology group: K02868, large subunit ribosomal protein L11e (inferred from 84% identity to ppl:POSPLDRAFT_114008)

Predicted SEED Role

"LSU ribosomal protein L11e (L5p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>mRNA_8386 K02868 RP-L11e, RPL11 large subunit ribosomal protein L11e (Rhodosporidium toruloides IFO0880)
MSDAKATAQNPMRELRIEKLVINISVGESGDRLTRAAKVLEQLTGQTPVTSKARYTVRHF
GIRRNEKIAVHVTIRGPKAEEILERGLKVKEYELKKRNFSETGNFGFGIAEHIDLGIKYD
PGIGIFGMDFYVVMGRPGGRVARRKHCTSRVGFSHRVKREETMAWFKQRFDGILFGR